Q7K740 · 3D7 · 397 aa
N-terminusJunctionalRepeatC-terminus
Click a residue to filter. Double-click to zoom.
| Antibody | Region | Epitope observed | Footprint | VH germline | Isotype | KD | IC50 | PDB |
|---|---|---|---|---|---|---|---|---|
| 1392 Homo sapiens · wild-type | C-terminus | EPSDKHIKEYLNKIQNSLSTEWSPCSVTCGNGIQVRIKPGSANKPKDELDYANDIEKKICKMEKC | 314-314, 317-321, 324-334, 343-343, 346-346, 350-360, 369-371 | IGHV4-4*07 | TBU | TBU | TBU | 1 |
| 1393 Homo sapiens · wild-type | C-terminus | - | repeat frame | - | TBU | TBU | TBU | 1 |
| 1437 Homo sapiens · wild-type | C-terminus | - | repeat frame | - | TBU | TBU | TBU | 1 |
| 1488 Homo sapiens · wild-type | C-terminus | EPSDKHIKEYLNKIQNSLSTEWSPCSVTCGNGIQVRIKPGSANKPKDELDYANDIEKKICKMEKCS | 313-324, 327-327, 330-340, 343-347, 351-367, 370-375 | IGHV3-21*01 | TBU | TBU | TBU | 1 |
| 1502 Homo sapiens · wild-type | C-terminus | - | repeat frame | - | TBU | TBU | TBU | 1 |
| 1504 Homo sapiens · wild-type | C-terminus | - | repeat frame | - | TBU | TBU | TBU | 1 |
| 1512 Homo sapiens · wild-type | C-terminus | EEPSDKHIKEYLNKIQNSLSTEWSPCSVTCGNGIQVRIKPGSANKPKDELDYANDIEKKICKMEK | 309-318, 321-322, 325-325, 331-331, 338-352, 355-356, 360-362, 365-370 | IGHV3-30*01 | TBU | TBU | TBU | 1 |
| 1525 Homo sapiens · wild-type | C-terminus | - | repeat frame | - | TBU | TBU | TBU | 1 |
| 1534 Homo sapiens · wild-type | C-terminus | - | repeat frame | - | TBU | TBU | TBU | 1 |
| 1550 Homo sapiens · wild-type | C-terminus | - | repeat frame | - | TBU | TBU | TBU | 1 |
| 1710 Homo sapiens · wild-type | C-terminus | EPSDKHIKEYLNKIQNSLSTEWSPCSVTCGNGIQVRIKPGSANKPKDELDYANDIEKKICKMEKC | 314-321, 324-324, 327-330, 338-340, 347-364, 374-374 | IGHV3-21*01 | TBU | TBU | TBU | 1 +1 apo |
| 234 Homo sapiens · wild-type | C-terminus | EPSDKHIKEYLNKIQNSLSTEWSPCSVTCGNGIQVRIKPGSANKPKDELDYANDIEKKICKMEK | 310-310, 314-314, 317-321, 324-327, 331-331, 340-340, 345-348, 354-361, 364-370 | IGHV3-21*08 | TBU | TBU | TBU | 1 |
| 236 Homo sapiens · wild-type | C-terminus | PSDKHIKEYLNKIQNSLSTEWSPCSVTCGNGIQVRIKPGSANKPKDELDYANDIEKKICKME | 314-314, 317-333, 337-337, 343-345, 348-350, 353-360, 370-371 | IGHV3-48*01 | TBU | TBU | TBU | 1 |
| 352 Homo sapiens · wild-type | C-terminus | PSDKHIKEYLNKIQNSLSTEWSPCSVTCGNGIQVRIKPGSANKPKDELDYANDIEKKICKM | 313-314, 317-321, 324-324, 327-327, 331-333, 337-337, 343-343, 353-362, 370-371 | IGHV3-21*08 | TBU | TBU | TBU | 1 |
| 367 Homo sapiens · wild-type | C-terminus | - | repeat frame | - | TBU | TBU | TBU | 1 |
| 369 Homo sapiens · wild-type | C-terminus | - | repeat frame | - | TBU | TBU | TBU | 1 |
| 3764 Homo sapiens · wild-type | C-terminus | NMPNDPNRNV | 285-293 | IGHV3-33*01 | TBU | TBU | TBU | 1 |
| 389 Homo sapiens · wild-type | C-terminus | - | repeat frame | - | TBU | TBU | TBU | 1 |