Q7K740 · 3D7 · 397 aa
N-terminusJunctionalRepeatC-terminus
Click a residue to filter. Double-click to zoom.
| Antibody | Region | Epitope observed | Footprint | VH germline | Isotype | KD | IC50 | PDB |
|---|---|---|---|---|---|---|---|---|
| sdAb1 Lama glama · wild-type | C-terminus | PSDKHIKEYLNKIQNSLSTEWSPCSVTCGNGIQVRIKPGSANKPKDELDYANDIEKKICKMEKCS | 313-314, 317-333, 337-337, 345-345, 351-352, 355-361, 370-373 | IGHV3-23*01 | TBU | TBU | TBU | 1 |
| sdAb9 Lama glama · wild-type | C-terminus | EPSDKHIKEYLNKIQNSLSTEWSPCSVTCGNGIQVRIKPGSANKPKDELDYANDIEKKICKMEKCSS | 310-310, 313-314, 317-321, 324-326, 331-331, 337-340, 345-345, 351-370, 373-376 | IGHV3-23*01 | TBU | TBU | TBU | 1 |